PDB entry 5tqi

View 5tqi on RCSB PDB site
Description: Crystal structure of a pyridoxal kinase from Burkholderia multivorans
Class: transferase
Keywords: SSGCID, Burkholderia multivorans, pyridoxal kinase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2016-10-24, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase PdxY
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: pdxK, pdxY, BMULJ_01107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tqia1, d5tqia2
  • Chain 'B':
    Compound: Pyridoxal kinase PdxY
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: pdxK, pdxY, BMULJ_01107
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tqib1, d5tqib2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tqiA (A:)
    mahhhhhhmknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwags
    aidaakmeqlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdp
    amgqtggirpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliar
    gpkiilvkhlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrl
    rgdsvraafehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqiA (A:)
    hhmknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwagsaidaak
    meqlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdpamgqtg
    girpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliargpkiil
    vkhlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrlrgdsvr
    aafehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tqiB (B:)
    mahhhhhhmknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwags
    aidaakmeqlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdp
    amgqtggirpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliar
    gpkiilvkhlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrl
    rgdsvraafehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqiB (B:)
    hmknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwagsaidaakm
    eqlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdpamgqtgg
    irpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliargpkiilv
    khlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrlrgdsvra
    afehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv