PDB entry 5tq7

View 5tq7 on RCSB PDB site
Description: Design and Synthesis of a pan-JAK Kinase Inhibitor Clinical Candidate (PF-06263276) Suitable for Inhaled and Topical Delivery for the Treatment of Inflammatory Diseases of the Lungs and Skin
Class: Transferase/Transferase Inhibitor
Keywords: Kinase, Inflammation, Jak Inhibitor, Transferase-Transferase Inhibitor complex
Deposited on 2016-10-23, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-303)
      • engineered mutation (244)
      • engineered mutation (247)
      • engineered mutation (297)
    Domains in SCOPe 2.07: d5tq7a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (Start-303)
      • engineered mutation (244)
      • engineered mutation (247)
      • engineered mutation (297)
    Domains in SCOPe 2.07: d5tq7b_
  • Heterogens: 7GT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tq7A (A:)
    mghhhhhhedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhst
    eehlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeri
    dhikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyy
    kvkepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmignd
    kqgqsivthliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqvrd
    nmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tq7A (A:)
    ptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhehlrdfereieilk
    slqhdnivkykgvcysagnlklimeylpygslrdylqkhkeridhikllqytsqickgme
    ylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvespifwyapesltes
    kfsvasdvwsfgvvlyelftyieksksppaefmrmigsivthliellknngrlprpdgcp
    deiymimtecwnnnvnqrpsfrdlalrvdqvrdnmag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tq7B (B:)
    mghhhhhhedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhst
    eehlrdfereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeri
    dhikllqytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyy
    kvkepgespifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmignd
    kqgqsivthliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqvrd
    nmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tq7B (B:)
    qfeerhlkflqqlgkgnfgsvemcrydplntgevvavkklqhhlrdfereieilkslqhd
    nivkykgvcyrnlklimeylpygslrdylqkhkeridhikllqytsqickgmeylgtkry
    ihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvgespifwyapeslteskfsvas
    dvwsfgvvlyelftyieksksppaefmrmigsivthliellknngrlprpdgcpdeiymi
    mtecwnnnvnqrpsfrdlalrvdqvrdnmag