PDB entry 5tpx

View 5tpx on RCSB PDB site
Description: Bromodomain from Plasmodium Faciparum Gcn5, complexed with compound
Class: transferase
Keywords: Bromodomain, Transferase, Structural Genomics Consortium (SGC)
Deposited on 2016-10-21, released 2017-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase gcn5
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0823300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IB67 (18-122)
      • expression tag (17)
    Domains in SCOPe 2.06: d5tpxa1, d5tpxa2
  • Heterogens: CL, SO4, 7H7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tpxA (A:)
    mhhhhhhssgrenlyfqghkevqlkdqilgvldylekqqsawpflkpvslseapdyydii
    keptdiltmrrkarhgdyktkedfgielkrmfdncrlynapttiyfkyanelqtliwpky
    eai
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpxA (A:)
    ghkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgd
    yktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai