PDB entry 5tpw

View 5tpw on RCSB PDB site
Description: Crystal structure of amino terminal domains of the NMDA receptor subunit GluN1 and GluN2A in complex with zinc at the GluN2A
Class: transport protein
Keywords: ion channel, nmda receptor, allosteric modulation, zinc inhibition, transport protein
Deposited on 2016-10-21, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NMDA glutamate receptor subunit
    Species: Xenopus laevis [TaxId:8355]
    Gene: grin1, NR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91977 (0-384)
      • engineered mutation (37)
      • engineered mutation (347)
      • expression tag (385-388)
  • Chain 'B':
    Compound: Glutamate receptor ionotropic, NMDA 2A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grin2a
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TPW (0-End)
  • Chain 'L':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TPW (0-End)
    Domains in SCOPe 2.06: d5tpwl1, d5tpwl2
  • Heterogens: NAG, SO4, GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5tpwL (L:)
    divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyasqsisgips
    rfsgsgsgsdftltinsvepedvgmyycqnghsfprtfgggtkleikradaaptvsifpp
    sseqlaaggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpwL (L:)
    divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyaspsrfsgsg
    sgsdftltinsvepedvgmyycqnghsfprtfgggtkleikradaaptvsifppsseqla
    aggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkdey
    erhnsytceathktstspivksfnrn