PDB entry 5tpw
View 5tpw on RCSB PDB site
Description: Crystal structure of amino terminal domains of the NMDA receptor subunit GluN1 and GluN2A in complex with zinc at the GluN2A
Class: transport protein
Keywords: ion channel, nmda receptor, allosteric modulation, zinc inhibition, transport protein
Deposited on
2016-10-21, released
2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2016-12-14, with a file datestamp of
2016-12-09.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: NMDA glutamate receptor subunit
Species: Xenopus laevis [TaxId:8355]
Gene: grin1, NR1
Database cross-references and differences (RAF-indexed):
- Uniprot Q91977 (0-384)
- engineered mutation (37)
- engineered mutation (347)
- expression tag (385-388)
- Chain 'B':
Compound: Glutamate receptor ionotropic, NMDA 2A
Species: Rattus norvegicus [TaxId:10116]
Gene: Grin2a
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Fab, heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Fab, light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5tpwl1, d5tpwl2 - Heterogens: NAG, SO4, GOL, ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence, based on SEQRES records: (download)
>5tpwL (L:)
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyasqsisgips
rfsgsgsgsdftltinsvepedvgmyycqnghsfprtfgggtkleikradaaptvsifpp
sseqlaaggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec
Sequence, based on observed residues (ATOM records): (download)
>5tpwL (L:)
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyaspsrfsgsg
sgsdftltinsvepedvgmyycqnghsfprtfgggtkleikradaaptvsifppsseqla
aggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkdey
erhnsytceathktstspivksfnrn