PDB entry 5tpc

View 5tpc on RCSB PDB site
Description: Binding domain of BoNT/A complexed with ganglioside
Class: hydrolase
Keywords: binding domain, lectin, ganglioside binding, hydrolase
Deposited on 2016-10-20, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (3-423)
      • expression tag (0-2)
      • expression tag (424)
    Domains in SCOPe 2.06: d5tpca1, d5tpca2, d5tpca3, d5tpca4
  • Heterogens: GAL, SIA, NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tpcA (A:)
    hmdtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknai
    vynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqe
    ikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnn
    imfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyy
    mlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdn
    ivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqgit
    nkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipvddgwg
    erplq