PDB entry 5tpb

View 5tpb on RCSB PDB site
Description: Binding domain of BoNT/A complexed with ganglioside variant
Class: hydrolase
Keywords: binding domain, lectin, ganglioside binding, hydrolase
Deposited on 2016-10-20, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (22-442)
      • expression tag (20-21)
      • expression tag (443)
    Domains in SCOPe 2.06: d5tpba1, d5tpba2, d5tpba3, d5tpba4
  • Chain 'B':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (Start-442)
      • expression tag (443)
    Domains in SCOPe 2.06: d5tpbb1, d5tpbb2, d5tpbb3
  • Heterogens: SIA, GAL, NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tpbA (A:)
    mgsshhhhhhssglvprgshmdtsilnlryesnhlidlsryaskinigskvnfdpidknq
    iqlfnlesskievilknaivynsmyenfstsfwiripkyfnsislnneytiincmennsg
    wkvslnygeiiwtlqdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiying
    rlidqkpisnlgnihasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsn
    sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
    lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
    vgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqier
    ssrtlgcswefipvddgwgerplq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpbA (A:)
    mdtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaiv
    ynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqei
    kqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnni
    mfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyym
    lnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdni
    vrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqgitn
    kckmnlqdnngndigfigfhqfnniaklvasngcswefipvddgwgerplq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tpbB (B:)
    mgsshhhhhhssglvprgshmdtsilnlryesnhlidlsryaskinigskvnfdpidknq
    iqlfnlesskievilknaivynsmyenfstsfwiripkyfnsislnneytiincmennsg
    wkvslnygeiiwtlqdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiying
    rlidqkpisnlgnihasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsn
    sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
    lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
    vgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqier
    ssrtlgcswefipvddgwgerplq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpbB (B:)
    silnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyns
    myenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikqr
    vvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimfk
    ldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyymlnl
    ydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdnivrn
    ndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmksckmnlqdnngn
    digfigfhqfnniaklvasnwynrqrtlgcswefipvddgwgerplq