PDB entry 5tp5

View 5tp5 on RCSB PDB site
Description: Solution structure of the calcium deficient mutant calmodulin CaM1234
Class: signaling protein
Keywords: Calcium deficient, calmodulin, SIGNALING PROTEIN
Deposited on 2016-10-19, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (0-147)
      • engineered mutation (19)
      • engineered mutation (55)
      • engineered mutation (92)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d5tp5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tp5A (A:)
    adqlteeqiaefkeafslfakdgdgtittkelgtvmrslgqnpteaelqdminevaadgn
    gtidfpefltmmarkmkdtdseeeireafrvfakdgngyisaaelrhvmtnlgekltdee
    vdemireaaidgdgqvnyeefvqmmtak