PDB entry 5tp3

View 5tp3 on RCSB PDB site
Description: Crystal structure of the RSV-neutralizing single-domain antibody F-VHH-4
Class: immune system
Keywords: nanobody, respiratory syncytial virus, Ig fold, fusion glycoprotein, pseudomerohedral, IMMUNE SYSTEM
Deposited on 2016-10-19, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f-vhh-4
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TP3 (0-124)
    Domains in SCOPe 2.06: d5tp3a_
  • Chain 'B':
    Compound: f-vhh-4
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TP3 (0-124)
    Domains in SCOPe 2.06: d5tp3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tp3A (A:)
    qvqlqesggglvqpggslrlscaasgftldyyyigwfrqapgkereavscisgssgstyy
    pdsvkgrftisrdnakntvylqmnslkpedtavyycatirssswggcvhygmdywgkgtq
    vtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tp3B (B:)
    qvqlqesggglvqpggslrlscaasgftldyyyigwfrqapgkereavscisgssgstyy
    pdsvkgrftisrdnakntvylqmnslkpedtavyycatirssswggcvhygmdywgkgtq
    vtvss