PDB entry 5tou

View 5tou on RCSB PDB site
Description: structure of c-phycocyanin from arctic pseudanabaena sp. lw0831
Class: photosynthesis
Keywords: light-harversting pigment protein, photosynthesis
Deposited on 2016-10-18, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toua_
  • Chain 'B':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toub_
  • Chain 'C':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5touc_
  • Chain 'D':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toud_
  • Chain 'E':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toue_
  • Chain 'F':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5touf_
  • Chain 'G':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toug_
  • Chain 'H':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5touh_
  • Chain 'I':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toui_
  • Chain 'J':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5touj_
  • Chain 'K':
    Compound: Phycocyanin alpha-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5touk_
  • Chain 'L':
    Compound: Phycocyanin beta-1 subunit
    Species: Pseudanabaena sp. lw0831 [TaxId:1357935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toul_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touA (A:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touB (B:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touC (C:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touD (D:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touE (E:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touF (F:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touG (G:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touH (H:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touI (I:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touJ (J:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touK (K:)
    mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
    skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
    tfdlspswyvealkyvkanhglsgdsaveansyidyainals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5touL (L:)
    mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
    aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
    gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava