PDB entry 5tor

View 5tor on RCSB PDB site
Description: Crystal structure of AAT D222T mutant
Class: transferase
Keywords: transferase
Deposited on 2016-10-18, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Sus scrofa [TaxId:9823]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00503 (1-413)
      • expression tag (0)
      • conflict (64)
      • engineered mutation (223)
      • conflict (289)
      • conflict (377)
    Domains in SCOPe 2.07: d5tora1, d5tora2
  • Chain 'B':
    Compound: Aspartate aminotransferase, cytoplasmic
    Species: Sus scrofa [TaxId:9823]
    Gene: GOT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00503 (1-End)
      • expression tag (0)
      • conflict (64)
      • engineered mutation (223)
      • conflict (289)
      • conflict (377)
    Domains in SCOPe 2.07: d5torb1, d5torb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5torA (A:)
    gmappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveq
    riannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaef
    larwyngtnnkdtpvyvssptwenhngvfttagfkdirsyrywdtekrgldlqgflsdle
    napefsifvlhacahnptgtdptpeqwkqiasvmkrrflfpfftsayqgfasgnlekdaw
    airyfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnp
    paqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqig
    mfsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtkiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5torB (B:)
    gmappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveq
    riannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaef
    larwyngtnnkdtpvyvssptwenhngvfttagfkdirsyrywdtekrgldlqgflsdle
    napefsifvlhacahnptgtdptpeqwkqiasvmkrrflfpfftsayqgfasgnlekdaw
    airyfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnp
    paqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqig
    mfsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5torB (B:)
    gmappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveq
    riannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaef
    larwyngtnnkdtpvyvssptwenhngvfttagfkdirsyrywdtekrgldlqgflsdle
    napefsifvlhacahnptgtdptpeqwkqiasvmkrrflfpfftsayqgfasgnlekdaw
    airyfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnp
    paqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqig
    mfsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtki