PDB entry 5tof

View 5tof on RCSB PDB site
Description: Room temperature structure of ubiquitin variant u7ub25
Class: signaling protein
Keywords: computationally designed ubiquitin, usp7, signaling protein
Deposited on 2016-10-17, released 2017-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • conflict (1)
      • conflict (8-9)
      • conflict (14)
      • conflict (35)
      • conflict (70)
      • conflict (72)
    Domains in SCOPe 2.08: d5tofa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5tofA (A:)
gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqrlifagkqledgrtlsd
yniqkestlhgvrrlrgg

    Sequence, based on observed residues (ATOM records): (download) 
    >5tofA (A:)
gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqrlifagkqledgrtlsd
yniqkestlhgvr