PDB entry 5tnf

View 5tnf on RCSB PDB site
Description: Crystal structure of the E153Q mutant of the CFTR inhibitory factor Cif containing the adducted 19,20-EpDPE hydrolysis intermediate
Class: hydrolase/hydrolase inhibitor
Keywords: epoxide hydrolase, hydroxyalkyl-enzyme intermediate, hydrolase-hydrolase inhibitor complex
Deposited on 2016-10-14, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.06: d5tnfa_
  • Chain 'B':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.06: d5tnfb_
  • Chain 'C':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.06: d5tnfc_
  • Chain 'D':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.06: d5tnfd_
  • Heterogens: 7HW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tnfA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tnfA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tnfB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tnfB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tnfC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tnfC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tnfD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tnfD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh