PDB entry 5tn9

View 5tn9 on RCSB PDB site
Description: Crystal Structure of the ER-alpha Ligand-binding Domain (L372S,L536S) in Complex with the OBHS-BSC, 4-bromophenyl (1R,2R,4S)-5-(4-hydroxyphenyl)-6-(4-(2-(piperidin-1-yl)ethoxy)phenyl)-7-oxabicyclo[2.2.1]hept-5-ene-2-sulfonate
Class: transcription
Keywords: Nuclear receptor, transcription factor, ligand binding, protein-ligand complex, TRANSCRIPTION
Deposited on 2016-10-13, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (74)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d5tn9a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (74)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d5tn9b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (74)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d5tn9c_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (74)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d5tn9d_
  • Heterogens: 7EC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tn9A (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsy
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tn9A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytfsleekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehknvvpsydlllemlda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tn9B (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsy
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tn9B (B:)
    slalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltshd
    qvhllecawleilmiglvwrsmehpgkllfapnllldrnqgmveifdmllatssrfrmmn
    lqgeefvclksiillnsgveekdhihrvldkitdtlihlmakagltlqqqhqrlaqllli
    lshirhmsnkgmehlysvvpsydlllemlda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tn9C (C:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsy
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tn9C (C:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvytflksleekdhihrvldkitdtlihlmakagltl
    qqqhqrlaqlllilshirhmsnkgmehlysvvpsydlllemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tn9D (D:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsy
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tn9D (D:)
    slalsltadqmvsalldaeppilyseydsmmglltnladrelvhminwakrvpgfvdlts
    hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgmveifdmllatssrfrm
    mnlqgeefvclksiillnsgvytstlksleekdhihrvldkitdtlihlmakagltlqqq
    hqrlaqlllilshirhmsnkgmehlyvpsydlllemlda