PDB entry 5tlc

View 5tlc on RCSB PDB site
Description: Crystal structure of BdsA from Bacillus subtilis WU-S2B
Class: oxidoreductase
Keywords: Monooxygenase, OXIDOREDUCTASE
Deposited on 2016-10-11, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tlca_
  • Chain 'B':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tlcb_
  • Chain 'C':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tlcc_
  • Chain 'D':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tlcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tlcA (A:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tlcA (A:)
    qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaied
    snletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatldnls
    dgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedallldkvg
    grfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeavfsv
    spnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvhpev
    glstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlaelgrry
    gtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllqqrgv
    frteyegttlrehlglah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tlcB (B:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tlcB (B:)
    qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaien
    letgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatldnlsdg
    riswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedallldkvggr
    fadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeavfsvsp
    nldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvhpevgl
    stlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlaelgrrygt
    nvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllqqrgvfr
    teyegttlrehlglah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tlcC (C:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tlcC (C:)
    qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaied
    sygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatld
    nlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedallld
    kvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeav
    fsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvh
    pevglstlsshsglnlelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispa
    ylpgiyeefvdqvvpllqqrgvfrteyegttlrehlglah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tlcD (D:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tlcD (D:)
    qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglainl
    etgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatldnlsdgr
    iswnvvtslndsearnfgvlehdirydradefleavkklwsswsedallldkvggrfadp
    kkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeavfsvspnldi
    mravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvhpevglstls
    sgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpll
    qqrgvfrteyegttlrehlglah