PDB entry 5tk7

View 5tk7 on RCSB PDB site
Description: Structure of the HD-domain phosphohydrolase OxsA with Oxetanocin-A triphosphate bound
Class: metal binding protein
Keywords: phosphohydrolase, METAL BINDING PROTEIN
Deposited on 2016-10-06, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OxsA protein
    Species: Bacillus megaterium [TaxId:1404]
    Gene: oxsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tk7a_
  • Heterogens: MG, 7D4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tk7A (A:)
    msslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkekll
    lyalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnn
    dleiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlfl
    kdfplenknyryln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tk7A (A:)
    sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
    yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
    leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
    dfplenknyry