PDB entry 5tjr

View 5tjr on RCSB PDB site
Description: X-ray Crystal structure of a methylmalonate semialdehyde dehydrogenase from Pseudomonas sp. AAC
Class: oxidoreductase
Keywords: dehydrogenase, industrial biotechnology, hexamer, OXIDOREDUCTASE
Deposited on 2016-10-05, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjra_
  • Chain 'B':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjrb_
  • Chain 'C':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjrc_
  • Chain 'D':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjrd_
  • Chain 'E':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjre_
  • Chain 'F':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Pseudomonas sp. AAC [TaxId:1502784]
    Gene: FG99_15390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tjrf_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tjrA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrA (A:)
    mtlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntp
    pakraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkg
    eysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpss
    tlliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrg
    krvqalggaknhavlmpdadldnavsalmgaaygercmaisvavcvgdqiadalvqklvp
    qikgaardkvtgyidtgvaqgaelvvdgrlggtlfdrvtpemtiykeeifgpvlcivrvn
    sleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsfggwkr
    slfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tjrB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrB (B:)
    mtlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntp
    pakraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkg
    eysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpss
    tlliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrg
    krvqalggaknhavlmpdadldnavsalmgaaygcmaisvavcvgdqiadalvqklvpqi
    kglgaardkvtgyidtgvaqgaelvvdgrgykfflggtlfdrvtpemtiykeeifgpvlc
    ivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsf
    ggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tjrC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrC (C:)
    tlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntpp
    akraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkge
    ysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsst
    lliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgk
    rvqalggaknhavlmpdadldnavsalmgaaygsercmaisvavcvgdqiadalvqklvp
    qikglardkvtgyidtgvaqgaelvvdgrglggtlfdrvtpemtiykeeifgpvlcivrv
    nsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsfggwk
    rslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tjrD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrD (D:)
    tlikhliggeliadtgrtadvfnpstrkvpladretmqqaidaakaafpawrntppakra
    qvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkgeysrn
    vgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsstllia
    elfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgkrvqa
    lggaknhavlmpdadldnavsalmgaaygcmaisvavcvgdqiadalvqklvpqikglkg
    aardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgp
    vlcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvay
    hsfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tjrE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrE (E:)
    tlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntpp
    akraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkge
    ysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsst
    lliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgk
    rvqalggaknhavlmpdadldnavsalmgaaygrcmaisvavcvgdqiadalvqklvpqi
    krdkvtgyidtgvaqgaelvvdgrlggtlfdrvtpemtiykeeifgpvlcivrvnsleea
    mqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsfggwkrslfgd
    lhaygpdgvrfytkrkaitqrwpqrksheaaqfaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tjrF (F:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkgsmtlikhliggeliadtgrtadvfnpst
    geavrkvpladretmqqaidaakaafpawrntppakraqvlfrfkqlleaneerivklis
    eehgktiedaagelkrgienveyataapeilkgeysrnvgpnidawsdfqpigvvagitp
    fnfpamvplwmyplaiacgntfilkpserdpsstlliaelfheaglpkgvlnvvhgdkga
    vdalieapevkalsfvgstpiaeyiysegtkrgkrvqalggaknhavlmpdadldnavsa
    lmgaaygscgercmaisvavcvgdqiadalvqklvpqikglkigagtscgldmgplvtga
    ardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgpv
    lcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayh
    sfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfafpsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tjrF (F:)
    mtlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntp
    pakraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkg
    eysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpss
    tlliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrg
    krvqalggaknhavlmpdadldnavsalmgaaycmaisvavcvgdqiadalvqklvpqik
    grdkvtgyidtgvaqgaelvvdgrggtlfdrvtpemtiykeeifgpvlcivrvnsleeam
    qlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsfggwkrslfgdl
    haygpdgvrfytkrkaitqrwpqrksheaaqfaf