PDB entry 5tiu

View 5tiu on RCSB PDB site
Description: Crystal structure of SYK kinase domain with inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: Carboxamide Spleen Tyrosine Kinase (Syk), Transferase-Transferase Inhibitor complex
Deposited on 2016-10-03, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d5tiua1, d5tiua2
  • Heterogens: 7CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tiuA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tiuA (A:)
    vyldrklltledkelgtvkkgyyqmkkvvktvavkilkalkdellaeanvmqqldnpyiv
    rmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfvhr
    dlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfssks
    dvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydv
    enrpgfaavelrlrnyyydvvneghh