PDB entry 5th9

View 5th9 on RCSB PDB site
Description: Structure determination of a potent, selective antibody inhibitor of human MMP9 (GS-5745 bound to MMP-9)
Class: hydrolase/hydrolase inhibitor
Keywords: metalloproteinase-9 antibody inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2016-09-29, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9,Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Matrix metalloproteinase-9,Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Matrix metalloproteinase-9,Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: GS-5745 Fab heavy chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-End)
  • Chain 'I':
    Compound: GS-5745 Fab heavy chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-End)
  • Chain 'J':
    Compound: GS-5745 Fab heavy chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-End)
  • Chain 'L':
    Compound: GS-5745 Fab light chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-213)
    Domains in SCOPe 2.07: d5th9l1, d5th9l2
  • Chain 'M':
    Compound: GS-5745 Fab light chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-213)
    Domains in SCOPe 2.07: d5th9m1, d5th9m2
  • Chain 'N':
    Compound: GS-5745 Fab light chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TH9 (0-End)
    Domains in SCOPe 2.07: d5th9n_
  • Heterogens: ZN, CA, NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5th9L (L:)
    diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
    rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5th9M (M:)
    diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
    rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5th9N (N:)
    diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
    rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th9N (N:)
    diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
    rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkvei