PDB entry 5th1

View 5th1 on RCSB PDB site
Description: Crystal structure of H10 hemagglutinin mutant (K158aA-Q226L-G228S) from Jiangxi-Donghu (2013) H10N8 influenza virus in complex with 6'-SLNLN
Class: viral protein
Keywords: Influenza virus, hemagglutinin, HA, H10N8 (2013), Receptor specificity, VIRAL PROTEIN
Deposited on 2016-09-28, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252
      • engineered mutation (152)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5th1a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5th1b_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252 (Start-322)
      • engineered mutation (152)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5th1c_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5th1d_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252
      • engineered mutation (152)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5th1e_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5th1f_
  • Heterogens: SIA, GAL, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5th1A (A:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1A (A:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5th1B (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1B (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvktnte
    fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv
    rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5th1C (C:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1C (C:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5th1D (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1D (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektef
    esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
    kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5th1E (E:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1E (E:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5th1F (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5th1F (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlveknte
    fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv
    rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln