PDB entry 5tgv

View 5tgv on RCSB PDB site
Description: Crystal structure of H10 hemagglutinin mutant (K158aA-D193T-Q226L-G228S) from Jiangxi-Donghu (2013) H10N8 influenza virus in complex with 3'-SLN
Class: viral protein
Keywords: Influenza virus, hemagglutinin, HA, H10N8 (2013), Receptor specificity, VIRAL PROTEIN
Deposited on 2016-09-28, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252
      • engineered mutation (152)
      • engineered mutation (189)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5tgva_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tgvb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252 (Start-322)
      • engineered mutation (152)
      • engineered mutation (189)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5tgvc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tgvd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0J9X252
      • engineered mutation (152)
      • engineered mutation (189)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5tgve_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tgvf_
  • Heterogens: NAG, SIA, GAL, BMA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tgvA (A:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvA (A:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tgvB (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvB (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tgvC (C:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvC (C:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tgvD (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvD (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvetefe
    siesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrk
    qlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tgvE (E:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgih
    hpsstqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvE (E:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
    tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tgvF (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgvF (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln