PDB entry 5tgb

View 5tgb on RCSB PDB site
Description: Structure of chimeric 02-CB Fab, a VRC01-like germline antibody
Class: immune system
Keywords: Fab, germline, VRC01-like, CD4-BS, HIV-1, CDRH3, IMMUNE SYSTEM
Deposited on 2016-09-27, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 02-CB Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TGB (0-222)
  • Chain 'B':
    Compound: 02-CB Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TGB (0-End)
    Domains in SCOPe 2.07: d5tgbb1, d5tgbb2
  • Chain 'H':
    Compound: 02-CB Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TGB (0-End)
  • Chain 'L':
    Compound: 02-CB Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TGB
    Domains in SCOPe 2.07: d5tgbl1, d5tgbl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tgbB (B:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgbB (B:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5tgbL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tgbL (L:)
    ivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisslepedfavyycqqyeffgqgtkleikrtvaapsvfifppsdeql
    ksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskad
    yekhkvyacevthqglsspvtksfnrge