PDB entry 5tfs

View 5tfs on RCSB PDB site
Description: Structure of chimeric 02-K Fab, a VRC01-like germline antibody
Class: immune system
Keywords: Fab, HIV-1, VRC01, CDRH3, CD4-BS, Vh1-2, IMMUNE SYSTEM
Deposited on 2016-09-26, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 02-K Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TFS (0-216)
  • Chain 'L':
    Compound: 02-K Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5TFS
    Domains in SCOPe 2.07: d5tfsl1, d5tfsl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5tfsL (L:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqyeffgqgtkleikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tfsL (L:)
    ivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgipd
    rfsgsgsgtdftltisrlepedfavyycqqyeffgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnr