PDB entry 5te8

View 5te8 on RCSB PDB site
Description: Crystal structure of the midazolam-bound human CYP3A4
Class: oxidoreductase
Keywords: cytochrome P450, CYP3A4, monooxygenase, drug metabolism, midazolam, OXIDOREDUCTASE
Deposited on 2016-09-20, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08684
      • see remark 999 (1)
    Domains in SCOPe 2.07: d5te8a_
  • Chain 'B':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08684
      • see remark 999 (1)
    Domains in SCOPe 2.07: d5te8b_
  • Chain 'C':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08684
      • see remark 999 (1)
    Domains in SCOPe 2.07: d5te8c_
  • Heterogens: HEM, 08J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5te8A (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te8A (A:)
    aylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpv
    laitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgk
    lkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqd
    pfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrl
    dtqkhrvdflqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdv
    qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
    ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
    almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5te8B (B:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te8B (B:)
    aylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpv
    laitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgk
    lkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqd
    pfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrl
    edtqkhrvdflqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpd
    vqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingm
    fipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmr
    falmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5te8C (C:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te8C (C:)
    aylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpv
    laitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgk
    lkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqd
    pfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrl
    edtqkhrvdflqlmidsqnskalsdlelvaqsiififagyettssvlsfimyelathpdv
    qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
    ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
    almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr