PDB entry 5tdu

View 5tdu on RCSB PDB site
Description: Toluene 4-monooxygenase (T4moHD) bound to product after turnover in crystal
Class: oxidoreductase
Keywords: Diiron, OXIDOREDUCTASE
Deposited on 2016-09-19, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene-4-monooxygenase system protein A
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00456
      • conflict (335-336)
    Domains in SCOPe 2.07: d5tdua_
  • Chain 'B':
    Compound: Toluene-4-monooxygenase system protein E
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoE
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Toluene-4-monooxygenase system protein B
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tduc_
  • Chain 'E':
    Compound: toluene-4-monooxygenase system protein d
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tdue_
  • Heterogens: FE, PCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tduA (A:)
    mamhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvs
    iqrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfska
    pgnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddii
    tgrdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggp
    alqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiig
    qferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwlee
    kypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsle
    hngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemg
    kdahdfawadkck
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tduA (A:)
    amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
    qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
    gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
    grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
    lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
    ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
    ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
    ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
    dahdfawadk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tduC (C:)
    msafpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstel
    fprdmtiaesglnptevidvvfee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tduC (C:)
    safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
    prdmtiaesglnptevidvvfee
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tduE (E:)
    mstladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegelilt
    rktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tduE (E:)
    stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
    ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm