PDB entry 5tch

View 5tch on RCSB PDB site
Description: Crystal structure of tryptophan synthase from M. tuberculosis - ligand-free form, TrpA-G66V mutant
Class: lyase
Keywords: PLP, heterotetramer, amino acid biosynthesis, substrate channeling, allostery, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE
Deposited on 2016-09-15, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFY1
      • engineered mutation (65)
    Domains in SCOPe 2.06: d5tcha_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFY1
      • engineered mutation (65)
    Domains in SCOPe 2.06: d5tchc_
  • Chain 'D':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFY1
      • engineered mutation (65)
    Domains in SCOPe 2.06: d5tche_
  • Chain 'F':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFY1
      • engineered mutation (65)
    Domains in SCOPe 2.06: d5tchg_
  • Chain 'H':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tchA (A:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpvmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tchA (A:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrlg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tchC (C:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpvmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tchC (C:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tchE (E:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpvmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tchE (E:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tchG (G:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpvmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tchG (G:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvrl
    

  • Chain 'H':
    No sequence available.