PDB entry 5tbx

View 5tbx on RCSB PDB site
Description: hnRNP A18 RNA Recognition Motif
Class: RNA binding protein
Keywords: RNA-binding protein, RNA BINDING PROTEIN
Deposited on 2016-09-13, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold-inducible RNA-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CIRBP, A18HNRNP, CIRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tbxa_
  • Chain 'B':
    Compound: Cold-inducible RNA-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CIRBP, A18HNRNP, CIRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14011 (1-91)
      • expression tag (0)
    Domains in SCOPe 2.07: d5tbxb1, d5tbxb2
  • Heterogens: ACT, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tbxA (A:)
    gmasdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidd
    akdammamngksvdgrqirvdqagkssdnrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tbxA (A:)
    sdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfeniddakd
    ammamngksvdgrqirvdqagks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tbxB (B:)
    gmasdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvtfenidd
    akdammamngksvdgrqirvdqagkssdnrsr