PDB entry 5tbt

View 5tbt on RCSB PDB site
Description: Crystal Structure of Isoform 2 of Purine Nucleoside Phosphorylase complexed with Cytidine
Class: transferase
Keywords: transferase
Deposited on 2016-09-13, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tbta_
  • Heterogens: CTN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tbtA (A:)
    mttpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpk
    ttvaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlag
    ginrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkia
    qendfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlav
    sliannsildaendvsinhekvlavaekradllqmwfkeiitrlpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tbtA (A:)
    vvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttva
    ghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginr
    klksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqend
    fqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavslia
    nnsildaendvsinhekvlavaekradllqmwfkeiitrlpld