PDB entry 5tb7

View 5tb7 on RCSB PDB site
Description: Structure of nitrite reductase AniA from Neisseria gonorrhoeae, space group P212121
Class: oxidoreductase
Keywords: ngo1276, oxidoreductase
Deposited on 2016-09-11, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: NGO_1276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tb7a1, d5tb7a2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: NGO_1276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tb7b1, d5tb7b2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: NGO_1276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tb7c1, d5tb7c2
  • Heterogens: CU, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tb7A (A:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavprgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tb7A (A:)
    gelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrm
    irvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpgly
    iyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmd
    kavaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyv
    eggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenp
    eimtqklsdtay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tb7B (B:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavprgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tb7B (B:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    imtqklsdtay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tb7C (C:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavprgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tb7C (C:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaiagdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    imtqklsdtay