PDB entry 5taj

View 5taj on RCSB PDB site
Description: Conformational Sampling Differences across the Arrhenius Plot Biphasic Break Point at Ambient Temperature in the Enzyme Thermolysin
Class: hydrolase
Keywords: conformational sampling, room temperature, thermolysin, Arrhenius break, HYDROLASE
Deposited on 2016-09-10, released 2017-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Gene: npr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5taja_
  • Heterogens: CA, ZN, VAL, LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tajA (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk