PDB entry 5t9p

View 5t9p on RCSB PDB site
Description: Structural analysis reveals the flexible C-terminus of Nop15 undergoes rearrangement to recognize a pre-ribosomal RNA folding intermediate
Class: ribosomal protein
Keywords: Nop15, RRM, RIBOSOMAL PROTEIN
Deposited on 2016-09-09, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome biogenesis protein 15
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: NOP15, YNL110C, N1954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t9pa_
  • Chain 'B':
    Compound: Ribosome biogenesis protein 15
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: NOP15, YNL110C, N1954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t9pb_
  • Chain 'C':
    Compound: Ribosome biogenesis protein 15
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: NOP15, YNL110C, N1954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t9pc_
  • Chain 'D':
    Compound: Ribosome biogenesis protein 15
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: NOP15, YNL110C, N1954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t9pd_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t9pA (A:)
    kdkktleeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefv
    nkedamiaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9pA (A:)
    eysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedami
    aqesmnnyllmghllqvrvlpkgakieklykykkrvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t9pB (B:)
    kdkktleeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefv
    nkedamiaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9pB (B:)
    eeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedam
    iaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t9pC (C:)
    kdkktleeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefv
    nkedamiaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9pC (C:)
    leeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkeda
    miaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5t9pD (D:)
    kdkktleeysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefv
    nkedamiaqesmnnyllmghllqvrvlpkgakieklykykkrvlvekgitk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9pD (D:)
    eysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedami
    aqesmnnyllmghllqvrvlpkgakieklyk