PDB entry 5t8j

View 5t8j on RCSB PDB site
Description: Synthesis and biological evaluation of novel selective androgen receptor modulators (SARMs). Part II: Optimization of 4-(pyrrolidin-1-yl)benzonitrile derivatives
Class: hormone receptor
Keywords: Androgen Receptor, selective androgen receptor modulators, SARMS, HORMONE RECEPTOR
Deposited on 2016-09-07, released 2017-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5t8ja_
  • Heterogens: GOL, 77T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t8jA (A:)
    mhhhhhhgspiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwaka
    lpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmy
    sqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldri
    iackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisv
    qvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t8jA (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq