PDB entry 5t7c

View 5t7c on RCSB PDB site
Description: Solution structure of calcium free, myristoylated visinin-like protein 3
Class: membrane protein
Keywords: calmodulin, Hippocalcin, neuronal calcium sensor, MEMBRANE PROTEIN
Deposited on 2016-09-02, released 2017-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hippocalcin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HPCAL1, BDR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37235 (1-End)
      • myristoylation (0)
    Domains in SCOPe 2.06: d5t7ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t7cA (A:)
    xgkqnsklrpevlqdlrenteftdhelqewykgflkdcptghltvdefkkiyanffpygd
    askfaehvfrtfdtngdgtidfrefiialsvtsrgkleqklkwafsmydldgngyisrse
    mleivqaiykmvssvmkmpedestpekrtdkifrqmdtnndgklsleefirgaksdpsiv
    rllqcdpssasqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t7cA (A:)
    xgkqnsklrpevlqdlrenteftdhelqewykgflkdcptghltvdefkkiyanffpygd
    askfaehvfrtfdtngdgtidfrefiialsvtsrgkleqklkwafsmydldgngyisrse
    mleivqaiykmvssvmkmpedestpekrtdkifrqmdtnndgklsleefirgaksdpsiv
    rllqcd