PDB entry 5t52

View 5t52 on RCSB PDB site
Description: lectin from bauhinia forficata in complex with galnac
Class: sugar binding protein
Keywords: legume lectin, concanavalin a, galnac-specific, ligand-free, sugar binding protein
Deposited on 2016-08-30, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Bauhinia forficata [TaxId:413686]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5t52a_
  • Chain 'B':
    Compound: lectin
    Species: Bauhinia forficata [TaxId:413686]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5t52b_
  • Heterogens: CA, NGA, EDO, A2G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t52A (A:)
    selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
    fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
    twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
    pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststnllrdgarhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t52A (A:)
    selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
    fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
    twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
    pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t52B (B:)
    selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
    fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
    twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
    pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststnllrdgarhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t52B (B:)
    selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
    fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
    twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
    pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn