PDB entry 5t4t

View 5t4t on RCSB PDB site
Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Asp110Asn - Apo No Halide
Class: hydrolase
Keywords: Homodimer, Hydrolase, Dehalogenase
Deposited on 2016-08-30, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1 (2-End)
      • expression tag (1)
      • engineered mutation (111)
    Domains in SCOPe 2.06: d5t4ta1, d5t4ta2
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1
      • engineered mutation (111)
    Domains in SCOPe 2.06: d5t4tb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t4tA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t4tA (A:)
    hmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfk
    vivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrl
    aldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvk
    aklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnk
    ipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t4tB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t4tB (B:)
    adlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvivad
    lpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlaldsp
    grlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkaklas
    wtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvpm
    lalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs