PDB entry 5t3y

View 5t3y on RCSB PDB site
Description: Solution structure of response regulator protein from Burkholderia multivorans
Class: signaling protein
Keywords: response regulator, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, SIGNALING PROTEIN
Deposited on 2016-08-26, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two-component system response regulator
    Species: Burkholderia multivorans [TaxId:87883]
    Gene: WK80_10940
    Database cross-references and differences (RAF-indexed):
    • PDB 5T3Y (0-124)
    Domains in SCOPe 2.07: d5t3ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t3yA (A:)
    mirtilaiddsatmrallhatlaqagyevtvaadgeagfdlaattaydlvltdqnmprks
    gleliaalrqlsayadtpilvlttegsdafkaaardagatgwiekpidpgvlvelvatls
    epaan