PDB entry 5t35

View 5t35 on RCSB PDB site
Description: The PROTAC MZ1 in complex with the second bromodomain of Brd4 and pVHL:ElonginC:ElonginB
Class: ligase
Keywords: PROTAC complex, targeted degradation, chromatin reader, ubiquitin ligase, bifunctional ligand, Ligase
Deposited on 2016-08-24, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35a_
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35b_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5t35c1, d5t35c2
  • Chain 'D':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35d_
  • Chain 'E':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35e_
  • Chain 'F':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35f_
  • Chain 'G':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5t35g1, d5t35g2
  • Chain 'H':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t35h_
  • Heterogens: 759, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t35A (A:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35A (A:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t35B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t35C (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35C (C:)
    mmyvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5t35D (D:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35D (D:)
    pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
    dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
    vrslyedledhpnvqkdlerltqeriahq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5t35E (E:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35E (E:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t35F (F:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5t35G (G:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35G (G:)
    mmyvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5t35H (H:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t35H (H:)
    pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
    dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
    vrslyedledhpnvqkdlerltqeria