PDB entry 5t2z

View 5t2z on RCSB PDB site
Description: Crystal Structure of Multi-drug Resistant HIV-1 Protease PR-S17 in Complex with Darunavir
Class: Hydrolase/Hydrolase inhibitor
Keywords: Protease, Hydrolase, inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on 2016-08-24, released 2017-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot I7BFC3 (0-98)
    • engineered mutation (45)
    • engineered mutation (47)
    • engineered mutation (66)
    • engineered mutation (76)
    • engineered mutation (81)
    • engineered mutation (92)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5t2za_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot I7BFC3 (0-98)
    • engineered mutation (45)
    • engineered mutation (47)
    • engineered mutation (66)
    • engineered mutation (76)
    • engineered mutation (81)
    • engineered mutation (92)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5t2zb_
• Heterogens: 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5t2zA (A:)
  pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
  qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5t2zB (B:)
  pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
  qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf