PDB entry 5t23

View 5t23 on RCSB PDB site
Description: PI3Kg IN COMPLEX WITH 5d
Class: transferase
Keywords: PI3Kg, Inhibitor, TRANSFERASE
Deposited on 2016-08-23, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t23a1, d5t23a2, d5t23a3, d5t23a4
  • Heterogens: 74F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t23A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t23A (A:)
    esqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtsk
    plpeylwkkianncifivihrttsqtikvspddtpgailqdfvlrvcgrdeylvgetpik
    nfqwvrhclkngeeihvvldtppdpaldevrkvslwdcdrkfrvkirgidipvtvfvean
    iqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycqllyyvnllli
    dhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnychpialpkraempn
    qlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyq
    llarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkf
    epyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtaml
    hdftqqvqviemlqkvtldikslsassqvisqlkqklenlqnsqlpesfrvpydpglkag
    alaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesi
    wetesldlcllpygcistgdkigmieivkdattiakiqqkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfvltpdflfvmg
    tsgtsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmkedieyirdaltvgkneed
    akkyfldqievcrdkgwtvqfnwf