PDB entry 5t1o

View 5t1o on RCSB PDB site
Description: Solution-state NMR and SAXS structural ensemble of NPr (1-85) in complex with EIN-Ntr (170-424)
Class: transferase
Keywords: PTSNtr, phosphotransfer, bacterial, complex, TRANSFERASE
Deposited on 2016-08-19, released 2016-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR;SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein NPr
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: ptsO, Z4569, ECs4085
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A9N2 (0-84)
  Domains in SCOPe 2.08: d5t1oa_
• Chain 'B':
  Compound: Phosphoenolpyruvate-protein phosphotransferase PtsP
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: ptsP, ygdF, ygdO, b2829, JW2797
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37177 (1-255)
    • engineered mutation (187)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5t1oA (A:)
  mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg
  rqieveatgpqeeealaavialfns
  

  
  
• Chain 'B':
  No sequence available.