PDB entry 5t17

View 5t17 on RCSB PDB site
Description: NMR structure of the E. coli protein NPr, residues 1-85
Class: transferase
Keywords: PTSNtr, phosphotransfer protein, HPr-like, biofilm, TRANSFERASE
Deposited on 2016-08-18, released 2016-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein NPr
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ptsO, Z4569, ECs4085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t17a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5t17A (A:)
mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg
rqieveatgpqeeealaavialfns