PDB entry 5szw

View 5szw on RCSB PDB site
Description: NMR solution structure of the RRM1 domain of the post-transcriptional regulator HuR
Class: RNA binding protein
Keywords: RNA-binding protein Post-trasncriptional regulation RNA recognition motif, RNA BINDING PROTEIN
Deposited on 2016-08-15, released 2017-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ELAV-like protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ELAVL1, HUR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15717 (2-100)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5szwa1, d5szwa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5szwA (A:)
  ghmsngyedhmaedcrgdigrtnlivnylpqnmtqdelrslfssigevesaklirdkvag
  hslgygfvnyvtakdaeraintlnglrlqsktikvsyarps