PDB entry 5szk

View 5szk on RCSB PDB site
Description: Structure of human N-terminally engineered Rab1b in complex with the bMERB domain of Mical-cL
Class: endocytosis
Keywords: Mical-cL, DUF3585, Mical, Rab effector, Rab1b, protein transport, endocytosis
Deposited on 2016-08-14, released 2016-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MICAL C-terminal-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MICALCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZW33 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0U4 (2-End)
      • engineered mutation (3-5)
    Domains in SCOPe 2.06: d5szkb_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5szkB (B:)
ghmaktydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktik
lqiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkll
vgnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmgpgaa
sggerpnlkidstpvkpagggcc

    Sequence, based on observed residues (ATOM records): (download) 
    >5szkB (B:)
maktydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklq
iwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvg
nksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm