PDB entry 5syn

View 5syn on RCSB PDB site
Description: Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ML349
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, inhibitor, thioesterase, hydrolase-hydrolase inhibitor complex
Deposited on 2016-08-11, released 2016-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5syna_
  • Chain 'B':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5synb_
  • Chain 'C':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5sync_
  • Chain 'D':
    Compound: Acyl-protein thioesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA2, APT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5synd_
  • Heterogens: 71T, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5synA (A:)
    mcgntmsvplltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphap
    ripvtlnmkmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlgg
    fsqggalslytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvp
    vrfgaltaeklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5synA (A:)
    plltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnm
    kmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggals
    lytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgalta
    eklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5synB (B:)
    mcgntmsvplltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphap
    ripvtlnmkmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlgg
    fsqggalslytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvp
    vrfgaltaeklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5synB (B:)
    plltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnm
    kmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggals
    lytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgalta
    eklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5synC (C:)
    mcgntmsvplltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphap
    ripvtlnmkmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlgg
    fsqggalslytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvp
    vrfgaltaeklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5synC (C:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrafpqangsakdlailqchgeldpmvpvrfgaltaek
    lrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5synD (D:)
    mcgntmsvplltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphap
    ripvtlnmkmvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlgg
    fsqggalslytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvp
    vrfgaltaeklrsvvtparvqfktypgvmhsscpqemaavkeflekllppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5synD (D:)
    lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
    mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
    ytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgaltae
    klrsvvtparvqfktypgvmhsscpqemaavkeflekllppv