PDB entry 5sym

View 5sym on RCSB PDB site
Description: Cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ML348
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, inhibitor, thioesterase, hydrolase-hydrolase inhibitor complex
Deposited on 2016-08-11, released 2016-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-protein thioesterase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA1, APT1, LPL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5syma_
  • Chain 'B':
    Compound: Acyl-protein thioesterase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLA1, APT1, LPL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5symb_
  • Heterogens: 71Q, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5symA (A:)
    mcgnnmstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrp
    vtlnmnvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsq
    ggalslytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplm
    fgsltveklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5symA (A:)
    tplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnmnv
    ampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggalsly
    talttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgsltve
    klktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5symB (B:)
    mcgnnmstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrp
    vtlnmnvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsq
    ggalslytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplm
    fgsltveklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5symB (B:)
    tplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnmnv
    ampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggalsly
    talttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgsltve
    klktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppid