PDB entry 5sxw

View 5sxw on RCSB PDB site
Description: Crystal structure of the E198A variant of catalase-peroxidase KatG of Burkholderia pseudomallei
Class: oxidoreductase
Keywords: catalase-peroxidase, E198A variant, tuberculosis isonicotinic acid hydrazide, oxidoreductase, KatG
Deposited on 2016-08-10, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JNW6 (Start-727)
      • engineered mutation (177)
    Domains in SCOPe 2.06: d5sxwa1, d5sxwa2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JNW6 (Start-727)
      • engineered mutation (177)
    Domains in SCOPe 2.06: d5sxwb1, d5sxwb2
  • Heterogens: HEM, NA, OXY, PO4, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sxwA (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepadv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sxwA (A:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepadvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5sxwB (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepadv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sxwB (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepadvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla