PDB entry 5sx3

View 5sx3 on RCSB PDB site
Description: Crystal structure of the catalase-peroxidase KatG of B. pseudomaallei at pH 4.5
Class: oxidoreductase
Keywords: catalase-peroxidase, KatG, pH changes, oxidoreductase
Deposited on 2016-08-09, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5sx3a1, d5sx3a2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5sx3b1, d5sx3b2
  • Heterogens: HEM, NA, CL, OXY, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sx3A (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx3A (A:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5sx3B (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx3B (B:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla