PDB entry 5svz

View 5svz on RCSB PDB site
Description: HIV-1 Tat NLS in complex with importin alpha
Class: Transport Protein/Viral Protein
Keywords: HIV-1, Tat, Importin alpha, Virus, Complex, Transport Protein-Viral Protein complex
Deposited on 2016-08-08, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5svza_
  • Chain 'B':
    Compound: Tat
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SVZ
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5svzA (A:)
    mhhhhhhssglvprgsgmletaaalfernhmdspdlgtddddlamadigsnqgtvnwsve
    divkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcspiqfe
    sawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgsafrdl
    vikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrl
    lhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraign
    ivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglv
    pflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqv
    ildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyfsve
    eeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5svzA (A:)
    gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
    dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
    dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
    ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
    palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
    kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
    iekyfs
    

  • Chain 'B':
    No sequence available.