PDB entry 5svo

View 5svo on RCSB PDB site
Description: Structure of IDH2 mutant R140Q
Class: oxidoreductase
Keywords: inhibitor, isocitrate dehydrogenase, MITOCHONDRIAL, NADPH, OXIDOREDUCTASE
Deposited on 2016-08-06, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48735
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5svoa_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48735
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5svob_
  • Heterogens: NAP, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5svoA (A:)
    adkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfd
    knkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmle
    kvcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqslehhhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5svoA (A:)
    krikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsa
    latqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlv
    pgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgm
    yntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdkn
    kiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkt
    ieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekv
    cvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5svoB (B:)
    adkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtid
    salatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiicknipr
    lvpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgm
    gmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfd
    knkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdg
    ktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmle
    kvcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqslehhhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5svoB (B:)
    rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
    atqkysvavkcatitwkspngtiqnilggtvfrepiickniprlvpgwtkpitigrhahg
    dqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmyntdesisgfahscf
    qyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknkiwyehrliddmvaq
    vlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgktieaeaahgtvtrhyr
    ehqstnpiasifawtrglehrgkldgnqdlirfaqmlekvcvetvesgamtkdlagcihg
    lsnvklnehflnttdfldtiksnldralg