PDB entry 5rxn

View 5rxn on RCSB PDB site
Description: combined crystallographic refinement and energy minimization of rubredoxin at 1.2 angstrom resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1984-10-15, released 1985-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 1991-10-15, with a file datestamp of 2007-07-20.
Experiment type: -
Resolution: 1.2 Å
R-factor: 0.096
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-53)
      • conflict (13)
      • conflict (21)
      • conflict (47)
    Domains in SCOP 1.73: d5rxna_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5rxnA (A:)
    mkkytctvcgyiydpedgdpddgvnpgtdfkdipddwvcplcgvgkdefeevee