PDB entry 5rub

View 5rub on RCSB PDB site
Description: crystallographic refinement and structure of ribulose-1,5-bisphosphate carboxylase from rhodospirillum rubrum at 1.7 angstroms resolution
Deposited on 1990-05-29, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5rubA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5rubA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    depqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgtssdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffe
    nlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfp
    gdadqiypgwrkalgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5rubB (B:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5rubB (B:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    depqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlg
    nanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgda
    dqiypgwrkalgv